PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07707A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 316aa    MW: 35555 Da    PI: 8.5442
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07707AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-161462148
                               TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                               +g+W++eEd +l+ +++q G+g +W + ++++g++R++k+c++rw++yl
  Oropetium_20150105_07707A 14 KGPWSPEEDAKLKSYIEQNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                               79*********************************************97 PP

2Myb_DNA-binding38.82.2e-1269111246
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                g +++eEd +++ +    G++ W+ Ia+ ++ gRt++++k++w++
  Oropetium_20150105_07707A  69 GGFSEEEDRIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                                569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.706962IPR017930Myb domain
SuperFamilySSF466892.0E-2611109IPR009057Homeodomain-like
SMARTSM007176.5E-121364IPR001005SANT/Myb domain
PfamPF002494.8E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-241569IPR009057Homeodomain-like
CDDcd001676.22E-91662No hitNo description
PROSITE profilePS5129422.33263117IPR017930Myb domain
SMARTSM007175.6E-1267115IPR001005SANT/Myb domain
PfamPF002493.9E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2370117IPR009057Homeodomain-like
CDDcd001673.91E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDAKLKSYIE QNGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDRIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLFGK  120
QSRKDQRQQQ QFMRXXXXXX XXXXXXXXXX XXXXXXXXXX YSWHQQTMAV PVQQPTMSGT  180
MMEGHRGGDE VDESIRKLLY KLGGSPFAAL PQCVAPPMYE GSPSFMPTSC QVETTSLHEG  240
GLQCSSGLPN LELDQNFHFN QVKLDGLDCF FGMGDQSMRW CEVNPLACSN NTVASTSQGM  300
QQYGLVDEQV NLGIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981607.11e-167PREDICTED: myb-related protein Myb4-like
TrEMBLK4ACS41e-167K4ACS4_SETIT; Uncharacterized protein
STRINGSi036681m1e-167(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-80myb domain protein 36